Sistema FMUSP-HC: Faculdade de Medicina da Universidade de São Paulo (FMUSP) e Hospital das Clínicas da FMUSPGARCEZ, Lais SpindolaLIMA, Geania de Sousa PazPAIVA, Adriana de AzevedoPAZ, Suzana Maria Rebelo Sampaio daGOMES, Erica Ivana LazaroNUNES, Valeria SuttiFARIA, Eliana Cotta deBARROS-MAZON, Silvia de2017-04-072017-04-072016NUTRIENTS, v.8, n.11, article ID 669, 11p, 20162072-6643https://observatorio.fm.usp.br/handle/OPI/19131Globally, vitamin A deficiency (VAD) affects about 19.1 million pregnant women. Its occurrence is classically associated with inadequate food intake and may also be associated with socioeconomic factors and the presence of infection. The aim of this study was to determine the factors related to serum retinol levels among pregnant teenagers. The sample consisted of 89 pregnant adolescents, from whom socioeconomic, obstetric, anthropometric, and food consumption data were collected. Serum concentrations of retinol and the supposed presence of infection were determined by high-performance liquid chromatography and C-reactive protein quantification, respectively. The serum retinol concentrations were classified according to the criteria of the World Health Organization. We adopted a 5% significance level for all statistical tests. Serum retinol levels were significantly and positively associated with sanitation (p = 0.008) and pre-gestational nutritional status (p = 0.002), and negatively with the trimester (p = 0.001). The appropriate sanitation conditions and pre-pregnancy body mass index (BMI) were shown to have a protective effect against VAD. Conversely, serum retinol levels were reduced with trimester progression, favoring VAD occurrence.engopenAccessVitamin A deficiencyvitamin Apregnancypregnancy in adolescencefood consumptionserum retinolvitamin-a-deficiencychildrenprevalencemotherswomenagearticleCopyright MDPI AG10.3390/nu8110669Nutrition & Dietetics